Product Browser

Last updated: 2017/8/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRDX5 (Human) Recombinant ProteinBioActive

  • Catalog # : P3489
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PRDX5 (NP_036226, 53 a.a. - 214 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 17
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Endotoxin Level:
  • < 1.0 EU per 1 microgram of protein (determined by LAL method)
  • Activity:
  • Specific activity: approximately 117-136 pmole/min/ug. Enzymatic activity was confirmed by measuring the remaining peroxide after incubation of PRDX5 and peroxide for 20 min at room temperature. Specific activity is defined as the amount of hydroperoxide
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3489
  • Storage Buffer:
  • In 20 mM HEPES, pH 7.4
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • PRDX5
  • Gene Alias:
  • ACR1,AOEB166,B166,MGC117264,MGC142283,MGC142285,PLP,PMP20,PRDX6,PRXV,SBBI10
  • Gene Description:
  • peroxiredoxin 5
  • Gene Summary:
  • This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms. Three transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • Alu co-repressor 1,TPx type VI,antioxidant enzyme B166,liver tissue 2D-page spot 71B,peroxisomal antioxidant enzyme,thioredoxin peroxidase PMP20
  • RSS
  • YouTube
  • Linkedin
  • Facebook