PRDX5 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PRDX5 full-length ORF ( NP_036226.1, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MGLAGVCALRRSAGYILVGGAGGQSAAAAARRCSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
48.4
Interspecies Antigen Sequence
Mouse (84); Rat (79)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PRDX5
Entrez GeneID
25824GeneBank Accession#
NM_012094.3Protein Accession#
NP_036226.1Gene Name
PRDX5
Gene Alias
ACR1, AOEB166, B166, MGC117264, MGC142283, MGC142285, PLP, PMP20, PRDX6, PRXV, SBBI10
Gene Description
peroxiredoxin 5
Omim ID
606583Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms. Three transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
Alu co-repressor 1|TPx type VI|antioxidant enzyme B166|liver tissue 2D-page spot 71B|peroxisomal antioxidant enzyme|thioredoxin peroxidase PMP20
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com