ABCC1 monoclonal antibody, clone IU5C1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against synthetic peptide of ABCC1.
Immunogen
A synthetic peptide corresponding to amino acids 1-33 of human ABCC1.
Sequence
SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF
Host
Mouse
Reactivity
Human, Mouse
Form
Liquid
Isotype
IgG1
Recommend Usage
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In buffer containing 0.09% sodium azide
Storage Instruction
Store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western blot analysis of ABCC1 in 10 ug of 293 transfected lysate using ABCC1 monoclonal antibody, clone IU5C1 (Cat # MAB2374). Lane 1 : empty vector. Lane 2 : ABCC1 transfected 293 lysate.Immunofluorescence
-
Gene Info — ABCC1
Entrez GeneID
4363Protein Accession#
P33527Gene Name
ABCC1
Gene Alias
ABC29, ABCC, DKFZp686N04233, DKFZp781G125, GS-X, MRP, MRP1
Gene Description
ATP-binding cassette, sub-family C (CFTR/MRP), member 1
Omim ID
158343Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternative splicing by exon deletion results in several splice variants but maintains the original open reading frame in all forms. [provided by RefSeq
Other Designations
ATP-binding cassette, sub-family C, member 1|LTC4 transporter|OTTHUMP00000045904|leukotriene C(4) transporter|multidrug resistance protein|multiple drug resistance protein 1|multiple drug resistance-associated protein
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The amino terminus of the human multidrug resistance transporter ABCC1 has a U-shaped folding with a gating function.
Chen Q, Yang Y, Li L, Zhang JT.
The Journal of Biological Chemistry 2006 Oct; 281(41):31152.
Application:Flow Cyt, WB-Tr, Human, HEK 293, MCF-7 cells.
-
The amino terminus of the human multidrug resistance transporter ABCC1 has a U-shaped folding with a gating function.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com