Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDK5RAP2 monoclonal antibody, clone CL3392

  • Catalog # : MAB15800
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against partial recombinant human CDK5RAP2.
  • Immunogen:
  • Recombinant protein corresponding to human CDK5RAP2.
  • Sequence:
  • ELLEKLEKLFLNGKSVGVEMNTQNELMERIEEDNLTYQHLLPESPEPSASHALSDYETSEKSFFSRDQKQDNETEKTSVMV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Isotype:
  • IgG1
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Epitope:
  • This antibody binds to an epitope located within the peptide sequence YETSEKSFFS as determined by overlapping synthetic peptides.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human breast cancer with CDK5RAP2 monoclonal antibody, clone CL3392 (Cat # MAB15800) shows centrosome-like immunoreactivity in tumor cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of HeLa cells with CDK5RAP2 monoclonal antibody, clone CL3392 (Cat # MAB15800) (Green) shows specific the centrosome. Microtubule and nuclear probes are visualized in red and blue, respectively (where available).
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • CDK5RAP2
  • Gene Alias:
  • C48,Cep215,DKFZp686B1070,DKFZp686D1070,KIAA1633,MCPH3
  • Gene Description:
  • CDK5 regulatory subunit associated protein 2
  • Gene Summary:
  • Neuronal CDC2-like kinase, which is involved in the regulation of neuronal differentiation, is composed of a catalytic subunit, CDK5, and an activating subunit, p25NCK5A. The protein encoded by this gene binds to p25NCK5A and therefore may be involved in neuronal differentiation. The encoded protein may also be a substrate of neuronal CDC2-like kinase. Multiple transcript variants exist for this gene, but the full-length nature of only two has been determined. [provided by RefSeq
  • Other Designations:
  • CDK5 activator-binding protein C48,OTTHUMP00000022800,OTTHUMP00000064031,centrosomal protein 215 kDa
  • RSS
  • YouTube
  • Linkedin
  • Facebook