GAPDH monoclonal antibody, clone CL3265
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: HeLa, Lane 2: HEK 293, Lane 3: A-431, Lane 4: HepG2, Lane 5: NIH-3T3 and Lane 6: NBT-II cell lysates with GAPDH monoclonal antibody, clone CL3265 (Cat # MAB15797).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with GAPDH monoclonal antibody, clone CL3265 (Cat # MAB15797) shows immunoreactivity in neuropil as well as strong cytoplasmic positivity in a subset of cells.
-
Specification
Product Description
Mouse monoclonal antibody raised against partial recombinant human GAPDH.
Immunogen
Recombinant protein corresponding to human GAPDH.
Epitope
This antibody binds to an epitope located within the peptide sequence ERDPSKIKWGDAGAE as determined by overlapping synthetic peptides.
Sequence
TVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIIS
Host
Mouse
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Protein A purification
Isotype
IgG1
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:5000-1:10000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: HeLa, Lane 2: HEK 293, Lane 3: A-431, Lane 4: HepG2, Lane 5: NIH-3T3 and Lane 6: NBT-II cell lysates with GAPDH monoclonal antibody, clone CL3265 (Cat # MAB15797).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with GAPDH monoclonal antibody, clone CL3265 (Cat # MAB15797) shows immunoreactivity in neuropil as well as strong cytoplasmic positivity in a subset of cells. -
Gene Info — GAPDH
Entrez GeneID
2597Protein Accession#
P04406Gene Name
GAPDH
Gene Alias
G3PD, GAPD, MGC88685
Gene Description
glyceraldehyde-3-phosphate dehydrogenase
Omim ID
138400Gene Ontology
HyperlinkGene Summary
The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome. [provided by RefSeq
Other Designations
OTTHUMP00000174431|OTTHUMP00000174432|aging-associated gene 9 protein|glyceraldehyde 3-phosphate dehydrogenase
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Glycolysis / Gluconeogenesis
- Metabolic pathways
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com