Product Browser

Last updated: 2017/10/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

WWTR1 monoclonal antibody, clone CL0370

  • Catalog # : MAB15620
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against partial recombinant human WWTR1.
  • Immunogen:
  • Recombinant protein corresponding to human WWTR1.
  • Sequence:
  • MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Isotype:
  • IgG1
  • Recommend Usage:
  • Western Blot (1:500-1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of U-251 MG cell lysate with WWTR1 monoclonal antibody, clone CL0370 (Cat # MAB15620).
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • WWTR1
  • Gene Alias:
  • DKFZp586I1419,TAZ
  • Gene Description:
  • WW domain containing transcription regulator 1
  • Other Designations:
  • transcriptional co-activator with PDZ-binding motif (TAZ)
  • RSS
  • YouTube
  • Linkedin
  • Facebook