PODXL monoclonal antibody, clone CL0308
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against partial recombinant human PODXL.
Immunogen
Recombinant protein corresponding to human PODXL.
Epitope
This antibody binds to an epitope located within the peptide sequence IHTKLPAKDVYERLK as determined by overlapping synthetic peptides.
Sequence
LPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGD
Host
Mouse
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Isotype
IgG1
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human kidney tissue lysate with PODXL monoclonal antibody, clone CL0308 (Cat # MAB15600).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with PODXL monoclonal antibody, clone CL0308 (Cat # MAB15600) shows strong positivity in renal glomeruli. -
Gene Info — PODXL
Entrez GeneID
5420Protein Accession#
O00592Gene Name
PODXL
Gene Alias
Gp200, MGC138240, PC, PCLP
Gene Description
podocalyxin-like
Omim ID
602632Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the sialomucin protein family. The encoded protein was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering the outer aspect of the glomerular basement membrane. Other biological activities of the encoded protein include: binding in a membrane protein complex with Na+/H+ exchanger regulatory factor to intracellular cytoskeletal elements, playing a role in hematopoetic cell differentiation, and being expressed in vascular endothelium cells and binding to L-selectin. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
-
Publication Reference
-
Podocalyxin-like and RNA-binding motif protein 3 are prognostic biomarkers in urothelial bladder cancer: a validatory study.
Boman K, Andersson G, Wennersten C, Nodin B, Ahlgren G, Jirström K.
Biomarker Research 2017 Mar; 5:10.
-
Membranous expression of podocalyxin-like protein is an independent factor of poor prognosis in urothelial bladder cancer.
Boman K, Larsson AH, Segersten U, Kuteeva E, Johannesson H, Nodin B, Eberhard J, Uhlen M, Malmstrom PU, Jirstrom K.
British Journal of Cancer 2013 Jun; 108(11):2321.
Application:IHC-P, WB-Tr, Human, HEK 293 cells, Human urothelial bladder cancer.
-
Podocalyxin-like and RNA-binding motif protein 3 are prognostic biomarkers in urothelial bladder cancer: a validatory study.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com