Product Browser

Last updated: 2017/9/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PODXL monoclonal antibody, clone CL0285

  • Catalog # : MAB15592
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against partial recombinant human PODXL.
  • Immunogen:
  • Recombinant protein corresponding to human PODXL.
  • Sequence:
  • LPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Isotype:
  • IgG2b
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000)
    Western Blot (1:500-1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Epitope:
  • This antibody binds to an epitope located within the peptide sequence PAKDVYERLKDKWDE as determined by overlapping synthetic peptides.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western Blot analysis of human kidney tissue lysate with PODXL monoclonal antibody, clone CL0285 (Cat # MAB15592).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with PODXL monoclonal antibody, clone CL0285 (Cat # MAB15592) shows strong positivity in renal glomeruli and endothelial cells, but not in renal tubules.
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5420
  • Gene Name:
  • PODXL
  • Gene Alias:
  • Gp200,MGC138240,PC,PCLP
  • Gene Description:
  • podocalyxin-like
  • Gene Summary:
  • This gene encodes a member of the sialomucin protein family. The encoded protein was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering the outer aspect of the glomerular basement membrane. Other biological activities of the encoded protein include: binding in a membrane protein complex with Na+/H+ exchanger regulatory factor to intracellular cytoskeletal elements, playing a role in hematopoetic cell differentiation, and being expressed in vascular endothelium cells and binding to L-selectin. [provided by RefSeq
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook