IDH1 monoclonal antibody, clone CL0219
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against partial recombinant human IDH1.
Immunogen
Recombinant protein corresponding to human IDH1.
Epitope
This antibody binds to an epitope located within the peptide sequence IEDFAHSSFQMALSK as determined by overlapping synthetic peptides.
Sequence
FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY
Host
Mouse
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Isotype
IgG2a
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:5000-1:10000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of RT-4 cell lysate with IDH1 monoclonal antibody, clone CL0219 (Cat # MAB15566).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with IDH1 monoclonal antibody, clone CL0219 (Cat # MAB15566) shows strong positivity in a subset of renal tubules.Immunofluorescence
Immunofluorescent staining of A-431 cells with IDH1 monoclonal antibody, clone CL0219 (Cat # MAB15566) (Green) shows specific staining in the cytosol and nuclear bodies. Microtubule and nuclear probes are visualized in red and blue, respectively (where available). -
Gene Info — IDH1
Entrez GeneID
3417Protein Accession#
O75874Gene Name
IDH1
Gene Alias
IDCD, IDH, IDP, IDPC, PICD
Gene Description
isocitrate dehydrogenase 1 (NADP+), soluble
Omim ID
147700Gene Ontology
HyperlinkGene Summary
Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. [provided by RefSeq
Other Designations
NADP+-specific ICDH|NADP-dependent isocitrate dehydrogenase, cytosolic|NADP-dependent isocitrate dehydrogenase, peroxisomal|oxalosuccinate decarboxylase
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Citrate cycle (TCA cycle)
- Glutathione metabolism
+ View More Disease
-
Disease
- Adenoma
- Astrocytoma
- Blast Crisis
- Brain Neoplasms
- Carcinoma
- Chronic Disease
- Cleft Lip
- Cleft Palate
- Disease Progression
+ View More Disease
-
Publication Reference
-
An Anaplastic Pleomorphic Xanthoastrocytoma With Periventricular Extension: An Autopsy Case Report and Review of the Literature.
Yuki Matsumoto, Mikiko Kobayashi, Kunihiko Shingu, Ayako Tateishi, Maki Ohya, Kenji Sano, Tatsuya Negishi, Shohei Shigeto, Tatsuya Kobayashi, Yosuke Hara, Yukinari Kakizawa, Hiroyuki Kanno.
Neuropathology 2020 Oct; 40(5):507.
Application:IHC-P, Human, Human pleomorphic xanthoastrocytomas.
-
An Anaplastic Pleomorphic Xanthoastrocytoma With Periventricular Extension: An Autopsy Case Report and Review of the Literature.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com