OR2A2 monoclonal antibody (M01), clone 4B10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant OR2A2.
Immunogen
OR2A2 (NP_001005480.1, 261 a.a. ~ 318 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PDSNQREEQEKMLSLFHSVLNPMLNPLIYSLRNAQLKGALHRALQRKRSMRTVYGLCL
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged OR2A2 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — OR2A2
Entrez GeneID
442361GeneBank Accession#
NM_001005480Protein Accession#
NP_001005480.1Gene Name
OR2A2
Gene Alias
OR2A17P, OR2A2P, OR7-11, OST008
Gene Description
olfactory receptor, family 2, subfamily A, member 2
Gene Ontology
HyperlinkGene Summary
Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq
Other Designations
olfactory receptor OR7-11|olfactory receptor, family 2, subfamily A, member 17 pseudogene|olfactory receptor, family 2, subfamily A, member 2 pseudogene
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com