FBXW12 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human FBXW12 partial ORF ( NP_996985.1, 265 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LLRPSEGSDPLSTFLPHKLCASACWTPKVKNRITLMSQSSTGKKTEFITFDLTTKKTGGQTVIQAYEIASFQVAAHLKCPIWMGASDGYM
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.64
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — FBXW12
Entrez GeneID
285231GeneBank Accession#
NM_207102Protein Accession#
NP_996985.1Gene Name
FBXW12
Gene Alias
FBXO12, FBXO35, Fbw12, MGC120385, MGC120386, MGC120387
Gene Description
F-box and WD repeat domain containing 12
Omim ID
609075Gene Ontology
HyperlinkGene Summary
Members of the F-box protein family, such as FBXW12, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603034), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM
Other Designations
F-box and WD-40 domain protein 12|F-box only protein 35|F-box- and WD40-repeat-containing protein|OTTHUMP00000164809
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com