Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NCR3 (Human) Recombinant Protein (P01)

  • Catalog # : H00259197-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NCR3 full-length ORF ( NP_667341.1, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 48
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00259197-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • NCR3
  • Gene Alias:
  • 1C7,CD337,LY117,MALS,NKp30
  • Gene Description:
  • natural cytotoxicity triggering receptor 3
  • Gene Summary:
  • Natural cytotoxicity receptors (NCRs), such as NCR3, are activating natural killer (NK) cell receptors that belong to the immunoglobulin (Ig) superfamily. NCR3 is expressed in all resting and activated NK cells and forms a complex with CD3-zeta (CD3Z, or CD247; MIM 186780) (Sato et al., 2001 [PubMed 11782277]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000029162,OTTHUMP00000038859,OTTHUMP00000038863,lymphocyte antigen 117
  • RSS
  • YouTube
  • Linkedin
  • Facebook