Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

A2ML1 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00144568-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human A2ML1 protein.
  • Immunogen:
  • A2ML1 (AAH93840.1, 1 a.a. ~ 158 a.a) full-length human protein.
  • Sequence:
  • MYTLEASGQGCVYVQTVLRYNILPPTNMKTFSLSVEIGKARCEQPTSPRSLTLTIHTSYVGSRSSSNMAIVEVKMLSGFSPMEGTNQLLLQQPLVKKVEFGTDTLNIYLDELIKNTQTYTFTISQSVLVTNLKPATIKVYDYYLPDEQATIQYSDPCE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of A2ML1 expression in transfected 293T cell line (H00144568-T01) by A2ML1 MaxPab polyclonal antibody.

    Lane1:A2ML1 transfected lysate(17.38 KDa).
    Lane2:Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • A2ML1
  • Gene Alias:
  • CPAMD9,DKFZp686C1729,DKFZp686D2011,DKFZp686G1812,DKFZp686L1821,DKFZp686O1010,FLJ16045,FLJ25179,FLJ39129,FLJ41597,FLJ41598,FLJ41607
  • Gene Description:
  • alpha-2-macroglobulin-like 1
  • Gene Summary:
  • The alpha-macroglobulin (AM) superfamily of proteins contains both complement components and protease inhibitors, including A2M (MIM 103950) and A2ML1. AM proteins display a unique trap mechanism of inhibition, by which the AM inhibitor undergoes a major conformational change upon its cleavage by a protease, thus trapping the protease and blocking it from subsequent substrate binding (Galliano et al., 2006 [PubMed 16298998]).[supplied by OMIM
  • Other Designations:
  • C3 and PZP-like, alpha-2-macroglobulin domain containing 9,OTTHUMP00000158614
  • RSS
  • YouTube
  • Linkedin
  • Facebook