Product Browser

Last updated: 2017/12/10
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SENP8 monoclonal antibody (M06), clone 2E1

  • Catalog # : H00123228-M06
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant SENP8.
  • Immunogen:
  • SENP8 (NP_660205, 113 a.a. ~ 212 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • NSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLAKK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00123228-M06
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SENP8 expression in transfected 293T cell line by SENP8 monoclonal antibody (M06), clone 2E1.

    Lane 1: SENP8 transfected lysate(24.1 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged SENP8 is 0.3 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • SENP8
  • Gene Alias:
  • DEN1,HsT17512,NEDP1,PRSC2
  • Gene Description:
  • SUMO/sentrin specific peptidase family member 8
  • Gene Summary:
  • NEDD8 (MIM 603171) is a ubiquitin-like protein that becomes conjugated to the cullin (see CUL1; MIM 603134) subunit of several ubiquitin ligases. This conjugation, called neddylation, is required for optimal ubiquitin ligase activity. NEDD8-specific deneddylases, such as NEDP1, or DEN1, are required to process the NEDD8 propeptide at a C-terminal diglycine motif and to remove NEDD8 from cullins (Gan-Erdene et al., 2003 [PubMed 12759363]).[supplied by OMIM
  • Other Designations:
  • NEDD8-specific protease 1,SUMO/sentrin specific protease family member 8,deneddylase 1,protease, cysteine, 2 (NEDD8 specific),sentrin/SUMO-specific protease SENP8
  • RSS
  • YouTube
  • Linkedin
  • Facebook