Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SH2D1B purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00117157-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human SH2D1B protein.
  • Immunogen:
  • SH2D1B (NP_444512.2, 1 a.a. ~ 132 a.a) full-length human protein.
  • Sequence:
  • MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SH2D1B expression in transfected 293T cell line (H00117157-T01) by SH2D1B MaxPab polyclonal antibody.

    Lane 1: SH2D1B transfected lysate(14.52 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • SH2D1B
  • Gene Alias:
  • EAT2
  • Gene Description:
  • SH2 domain containing 1B
  • Gene Summary:
  • By binding phosphotyrosines through its free SRC (MIM 190090) homology-2 (SH2) domain, EAT2 regulates signal transduction through receptors expressed on the surface of antigen-presenting cells (Morra et al., 2001 [PubMed 11689425]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000029531,SH2 domain-containing molecule EAT2
  • RSS
  • YouTube
  • Linkedin
  • Facebook