Product Browser

Last updated: 2017/7/16

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MAL2 (Human) Recombinant Protein (P01)

  • Catalog # : H00114569-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MAL2 full-length ORF ( AAH12367, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSAGGASVPPPPNPAVSFPPPRVTLPAGPDILRTYSGAFVCLEILFGGLVWILVASSNVPLPLLQGWVMFVSVTAFFFSLLFLGMFLSGMVAQIDANWNFLDFAYHFTVFVFYFGAFLLEAAATSLHDLHCNTTITGQPLLSDNQYNINVAASIFAFMTTACYGCSLGLALRRWRP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44.99
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00114569-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • MAL2
  • Gene Alias:
  • -
  • Gene Description:
  • mal, T-cell differentiation protein 2
  • Gene Summary:
  • This gene encodes a multispan transmembrane protein belonging to the MAL proteolipid family. The protein is a component of lipid rafts and, in polarized cells, it primarily localizes to endosomal structures beneath the apical membrane. It is required for transcytosis, an intracellular transport pathway used to deliver membrane-bound proteins and exogenous cargos from the basolateral to the apical surface. [provided by RefSeq
  • Other Designations:
  • MAL proteolipid protein 2,MAL2 proteolipid protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook