MCM8 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human MCM8 partial ORF ( AAH08830, 646 a.a. - 735 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
TYSDEFGNLDFERSQHGSGMSNRSTAKRFISALNNVAERTYNNIFQFHQLRQIAKELNIQVADFENFIGSLNDQGYLLKKGPKVYQLQTM
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.53
Interspecies Antigen Sequence
Mouse (96); Rat (97)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — MCM8
Entrez GeneID
84515GeneBank Accession#
BC008830Protein Accession#
AAH08830Gene Name
MCM8
Gene Alias
C20orf154, MGC119522, MGC119523, MGC12866, MGC4816, REC, dJ967N21.5
Gene Description
minichromosome maintenance complex component 8
Omim ID
608187Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. This protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
Other Designations
DNA replication licensing factor MCM8|MCM8 minichromosome maintenance deficient 8|OTTHUMP00000030217|OTTHUMP00000030218|REC homolog
-
Interactome
-
Disease
-
Publication Reference
-
The selection and characterization of antibodies to minichromosome maintenance proteins that highlight cervical dysplasia.
Henderson D, Hall L, Prpic N, Hessling J, Parker M, Sampson S, Simkins S, Brough G, Dixon E, Lenz K, Knapp S, Murphy P, Taylor A, Fischer T, Malinowski DP.
J Immunol Methods 2011 May; 370:1.
Application:WB, Recombinant protein.
-
The selection and characterization of antibodies to minichromosome maintenance proteins that highlight cervical dysplasia.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com