MCM8 monoclonal antibody (M02), clone 1F9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MCM8 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.53 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MCM8.
Immunogen
MCM8 (AAH08830, 646 a.a. ~ 735 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TYSDEFGNLDFERSQHGSGMSNRSTAKRFISALNNVAERTYNNIFQFHQLRQIAKELNIQVADFENFIGSLNDQGYLLKKGPKVYQLQTM
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (97)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MCM8 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — MCM8
Entrez GeneID
84515GeneBank Accession#
BC008830Protein Accession#
AAH08830Gene Name
MCM8
Gene Alias
C20orf154, MGC119522, MGC119523, MGC12866, MGC4816, REC, dJ967N21.5
Gene Description
minichromosome maintenance complex component 8
Omim ID
608187Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. This protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
Other Designations
DNA replication licensing factor MCM8|MCM8 minichromosome maintenance deficient 8|OTTHUMP00000030217|OTTHUMP00000030218|REC homolog
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com