JAM3 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
JAM3 MaxPab rabbit polyclonal antibody. Western Blot analysis of JAM3 expression in human liver.
Western Blot (Tissue lysate)
JAM3 MaxPab rabbit polyclonal antibody. Western Blot analysis of JAM3 expression in mouse kidney.
Western Blot (Transfected lysate)
Western Blot analysis of JAM3 expression in transfected 293T cell line (H00083700-T01) by JAM3 MaxPab polyclonal antibody.
Lane 1: JAM3 transfected lysate(35.00 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human JAM3 protein.
Immunogen
JAM3 (AAH12147.1, 1 a.a. ~ 310 a.a) full-length human protein.
Sequence
MALRRPPRLRLCARLPDFFLLLLFRGCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLNIGGIIGGVLVVLAVLALITLGICCAYRRGYFINNKQDGESYKNPGKPDGVNYIRTDEEGDFRHKSSFVI
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
JAM3 MaxPab rabbit polyclonal antibody. Western Blot analysis of JAM3 expression in human liver.Western Blot (Tissue lysate)
JAM3 MaxPab rabbit polyclonal antibody. Western Blot analysis of JAM3 expression in mouse kidney.Western Blot (Transfected lysate)
Western Blot analysis of JAM3 expression in transfected 293T cell line (H00083700-T01) by JAM3 MaxPab polyclonal antibody.
Lane 1: JAM3 transfected lysate(35.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — JAM3
Entrez GeneID
83700GeneBank Accession#
BC012147.1Protein Accession#
AAH12147.1Gene Name
JAM3
Gene Alias
FLJ14529, JAM-C, JAMC
Gene Description
junctional adhesion molecule 3
Omim ID
606871Gene Ontology
HyperlinkGene Summary
Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, the this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions. The encoded protein is a member of the junctional adhesion molecule protein family and acts as a receptor for another member of this family. [provided by RefSeq
Other Designations
junctional adhesion molecule C
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com