GRINL1A monoclonal antibody (M04), clone 2E4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of GRINL1A expression in transfected 293T cell line by GRINL1A monoclonal antibody (M04), clone 2E4.
Lane 1: GRINL1A transfected lysate (Predicted MW: 41.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GRINL1A is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GRINL1A.
Immunogen
GRINL1A (NP_056347.1, 269 a.a. ~ 368 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GSPISSEERRRRDKQHLDDITAARLLPLHHMPTQLLSIEESLALQKQQKQNYEEMQAKLAAQKLAERLNIKMRSYNPEGESSGRYREVRDEDDDWSSDEF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (71); Rat (71)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of GRINL1A expression in transfected 293T cell line by GRINL1A monoclonal antibody (M04), clone 2E4.
Lane 1: GRINL1A transfected lysate (Predicted MW: 41.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GRINL1A is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — GRINL1A
Entrez GeneID
81488GeneBank Accession#
NM_015532Protein Accession#
NP_056347.1Gene Name
GRINL1A
Gene Alias
DKFZp586F1918
Gene Description
glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A
Omim ID
606485Gene Ontology
HyperlinkGene Summary
This gene (GRINL1A) is part of a complex transcript unit that includes the gene for GRINL1A combined protein (Gcom1). Transcription of this gene occurs at a downstream promoter, with at least three different alternatively spliced variants, grouped together as Gdown for GRINL1A downstream transcripts. The Gcom1 gene uses an upstream promoter for transcription and also has multiple alternatively spliced variants. [provided by RefSeq
Other Designations
GRINL1A downstream protein Gdown4|OTTHUMP00000163421
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com