Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DRF1 polyclonal antibody (A01)

  • Catalog # : H00080174-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant DRF1.
  • Immunogen:
  • DRF1 (NP_663696, 201 a.a. ~ 299 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • VKKQQPKKPEGTCPAAESRTRKVARLKAPFLKIEDESRKFRPFHHQFKSFPEISFLGPKDASPFEAPTTLGSMHHTRESKDGEPSPRSAAHTMPRRKKG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00080174-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • DBF4B
  • Gene Alias:
  • ASKL1,DRF1,FLJ13087,MGC15009,ZDBF1B,chifb
  • Gene Description:
  • DBF4 homolog B (S. cerevisiae)
  • Gene Summary:
  • This gene encodes a regulator of the CDC7-like 1 protein, a serine-threonine kinase which links cell cycle regulation to genome duplication. This protein localizes to the nucleus and its expression is cell cycle-regulated. Alternative splicing of this gene results in two transcript variants encoding different isoforms. Additional transcript variants have been described, but their full length sequences have not been determined. [provided by RefSeq
  • Other Designations:
  • DBF4 homolog B,Dbf4-related factor 1,activator of S-phase kinase-like protein 1,chiffon homolog B,zinc finger, DBF-type containing 1B
  • RSS
  • YouTube
  • Linkedin
  • Facebook