Product Browser

Last updated: 2017/4/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

APG3L polyclonal antibody (A01)

  • Catalog # : H00064422-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant APG3L.
  • Immunogen:
  • APG3L (NP_071933, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00064422-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • ATG3
  • Gene Alias:
  • APG3,APG3-LIKE,APG3L,DKFZp564M1178,FLJ22125,MGC15201,PC3-96
  • Gene Description:
  • ATG3 autophagy related 3 homolog (S. cerevisiae)
  • Gene Summary:
  • Autophagy is a process of bulk degradation of cytoplasmic components by the lysosome or vacuole. Human ATG3 displays the same enzymatic characteristics in vitro as yeast Apg3, a protein-conjugating enzyme essential for autophagy (Tanida et al., 2002 [PubMed 11825910]).[supplied by OMIM
  • Other Designations:
  • 2610016C12Rik,APG3 autophagy 3-like,Apg3p,autophagy Apg3p/Aut1p-like
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook