CDH26 monoclonal antibody (M04), clone 6C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CDH26 monoclonal antibody (M04), clone 6C10. Western Blot analysis of CDH26 expression in HeLa.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDH26 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (44.1 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant CDH26.
Immunogen
CDH26 (NP_068582.2, 1 a.a. ~ 165 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MKPLIWTWSDVEGQRPALLICTAAAGPTQGVKDLEEVPPSAASQSAQARCALGSWGYGKPFEPRSVKNIHSTPAYPDATMHRQLLAPVEGRMAETLNQKLHVANVLEDDPGYLPHVYSEEGECGGAPSLSSLASLEQELQPDLLDSLGSKATPFEEIYSESGVPS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (44); Rat (47)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (44.1 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CDH26 monoclonal antibody (M04), clone 6C10. Western Blot analysis of CDH26 expression in HeLa.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDH26 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — CDH26
Entrez GeneID
60437GeneBank Accession#
NM_021810.3Protein Accession#
NP_068582.2Gene Name
CDH26
Gene Alias
VR20
Gene Description
cadherin-like 26
Gene Ontology
HyperlinkGene Summary
Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues and modulate a wide variety of processes, including cell polarization and migration. Cadherin domains occur as repeats in the extracellular region and are thought to contribute to the sorting of heterogeneous cell types and the maintenance of orderly structures such as epithelium. This gene encodes a cadherin domain-containing protein whose specific function has not yet been determined. Alternative splicing occurs at this locus and two transcript variants, encoding distinct proteins, have been identified. [provided by RefSeq
Other Designations
cadherin-like protein VR20
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com