JAM2 monoclonal antibody (M02), clone 1C2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant JAM2.
Immunogen
JAM2 (AAH17779, 29 a.a. ~ 298 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNISGIIAAVVVVALVISVCGLGVCYAQRKGYFSKETSFQKSNSSSKATTMSENDFKHTKSFII
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (79); Rat (80)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (55.44 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of JAM2 expression in transfected 293T cell line by JAM2 monoclonal antibody (M02), clone 1C2.
Lane 1: JAM2 transfected lysate(33.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged JAM2 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — JAM2
Entrez GeneID
58494GeneBank Accession#
BC017779Protein Accession#
AAH17779Gene Name
JAM2
Gene Alias
C21orf43, CD322, JAM-B, JAMB, PRO245, VE-JAM, VEJAM
Gene Description
junctional adhesion molecule 2
Omim ID
606870Gene Ontology
HyperlinkGene Summary
Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is localized in the tight junctions between high endothelial cells. It acts as an adhesive ligand for interacting with a variety of immune cell types and may play a role in lymphocyte homing to secondary lymphoid organs. [provided by RefSeq
Other Designations
JAM-IT/VE-JAM|OTTHUMP00000096100|junctional adhesion molecule B|vascular endothelial junction-associated molecule
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com