- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25865)
- MaxPab® Ab (16222)
- Monoclonal Ab (21397)
- Polyclonal Ab (27485)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9169)
- Ab Pairs/Kits (7698)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2015)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2113)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (17916)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > Monoclonal Ab > Human > Binding > Nucleic Acid Binding > SALL4 monoclonal antibody (M03), clone 6E3
SALL4 monoclonal antibody (M03), clone 6E3
- Catalog # : H00057167-M03
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 100 ug
- USD $ 319
- order now, ship next day
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Mouse monoclonal antibody raised against a partial recombinant SALL4.
- Immunogen:
- SALL4 (NP_065169, 954 a.a. ~ 1053 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Sequence:
- PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS
- Host:
- Mouse
- Reactivity:
- Human, Mouse
- Isotype:
- IgG1 Kappa
- Quality Control Testing:
- Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
- Storage Buffer:
- In 1x PBS, pH 7.2
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- MSDS:
Download
- Publication Reference
- 1.
- Metastatic seminomas in lymph nodes: CD10 immunoreactivity can be a pitfall of differential diagnosis.
Ota Y, Iihara K, Ryu T, Morikawa T, Fukayama MInt J Clin Exp Pathol. 2013;6(3):498-502. Epub 2013 Feb 15.
- 2.
- Mediastinal seminoma: A case report with special emphasis on sall4 as a new immunocytochemical marker.
Iwamoto N, Ishida M, Yoshida K, Kagotani A, Iwai M, Okabe H.Diagn Cytopathol. 2012 Feb 1. doi: 10.1002/dc.22826. [Epub ahead of print]
- 3.
- alpha-Fetoprotein-producing gastric carcinoma and combined hepatocellular and cholangiocarcinoma show similar morphology but different histogenesis with respect to SALL4 expression.
Ikeda H, Sato Y, Yoneda N, Harada K, Sasaki M, Kitamura S, Sudo Y, Ooi A, Nakanuma Y.Hum Pathol. 2012 Apr 17.
- 4.
- Beta-Catenin and K-RAS Synergize to Form Primitive Renal Epithelial Tumors with Features of Epithelial Wilms' Tumors.
Clark PE, Polosukhina D, Love H, Correa H, Coffin C, Perlman EJ, de Caestecker M, Moses HL, Zent R.Am J Pathol. 2011 Dec;179(6):3045-55. Epub 2011 Oct 8.
- 5.
- alpha-Fetoprotein-producing ovarian tumor in a postmenopausal woman with germ cell differentiation.
Meguro S, Yasuda M.Ann Diagn Pathol. 2011 Nov 4.
- 6.
- Immunoexpression of SALL4 in Wilms Tumors and Developing Kidney.
Deisch J, Raisanen J, Rakheja D.Pathol Oncol Res. 2011 Jan 22. [Epub ahead of print]
- 7.
- Specificity of brachyury in the distinction of chordoma from clear cell renal cell carcinoma and germ cell tumors: a study of 305 cases.
Sangoi AR, Karamchandani J, Lane B, Higgins JP, Rouse RV, Brooks JD, McKenney JK.Mod Pathol. 2010 Nov 19. [Epub ahead of print]
- 8.
- Expression Pattern of Stemness-Related Genes in Human Endometrial and Endometriotic Tissues.
Forte A, Schettino MT, Finicelli M, Cipollaro M, Colacurci N, Cobellis L, Galderisi U.Mol Med. 2009 Aug 17. [Epub ahead of print]
- 9.
- Markers that define stemness in ESC are unable to identify the totipotent cells in human preimplantation embryos.
Cauffman G, De Rycke M, Sermon K, Liebaers I, Van de Velde H.Hum Reprod. 2009 Jan;24(1):63-70. Epub 2008 Sep 29.
- Applications
- Western Blot (Cell lysate)
- SALL4 monoclonal antibody (M03), clone 6E3 Western Blot analysis of SALL4 expression in Hela NE ( Cat # L013V3 ).
- Protocol Download
- Western Blot (Cell lysate)
- SALL4 monoclonal antibody (M03), clone 6E3. Western Blot analysis of SALL4 expression in NIH/3T3(Cat # L018V1 ).
- Protocol Download
- Western Blot (Recombinant protein)
- Protocol Download
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
enlarge this image- Immunoperoxidase of monoclonal antibody to SALL4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.2 ug/ml]
- Protocol Download
- Sandwich ELISA (Recombinant protein)
- Detection limit for recombinant GST tagged SALL4 is approximately 1ng/ml as a capture antibody.
- Protocol Download
- Entrez GeneID:
- 57167
- GeneBank Accession#:
- NM_020436
- Protein Accession#:
- NP_065169
- Gene Name:
- SALL4
- Gene Alias:
- DRRS,HSAL4,MGC133050,ZNF797,dJ1112F19.1
- Gene Description:
- sal-like 4 (Drosophila)
- Gene Ontology:
- Hyperlink
- Gene Summary:
- The protein encoded by this gene may be a zinc finger transcription factor. Defects in this gene are a cause of Duane-radial ray syndrome (DRRS). [provided by RefSeq
- Other Designations:
- OTTHUMP00000031296,sal-like 4
- Related Disease
