SALL4 monoclonal antibody (M03J), clone 6E3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SALL4.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
SALL4 (NP_065169, 954 a.a. ~ 1053 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (71); Rat (71)
Preparation Method
Cell Culture Production
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SALL4 monoclonal antibody (M03J), clone 6E3. Western Blot analysis of SALL4 expression in Hela S3 NE.Western Blot (Cell lysate)
SALL4 monoclonal antibody (M03J), clone 6E3. Western Blot analysis of SALL4 expression in NIH/3T3.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SALL4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.2 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SALL4 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — SALL4
Entrez GeneID
57167GeneBank Accession#
NM_020436Protein Accession#
NP_065169Gene Name
SALL4
Gene Alias
DRRS, HSAL4, MGC133050, ZNF797, dJ1112F19.1
Gene Description
sal-like 4 (Drosophila)
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene may be a zinc finger transcription factor. Defects in this gene are a cause of Duane-radial ray syndrome (DRRS). [provided by RefSeq
Other Designations
OTTHUMP00000031296|sal-like 4
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com