STAP2 monoclonal antibody (M03), clone 6C7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
STAP2 monoclonal antibody (M03), clone 6C7. Western Blot analysis of STAP2 expression in IMR-32.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STAP2 is 3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.73 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant STAP2.
Immunogen
STAP2 (AAH00795, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MASALRPPRVPKPKGVLPSHYYESFLEKKGPCDRDYKKFWAGLQGLTIYFYNSNRDFQHVEKLNLGAFEKLTDEIPWGSSRDPGTHFSLILRDQEIKFKVETLECREMWK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (74); Rat (73)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
STAP2 monoclonal antibody (M03), clone 6C7. Western Blot analysis of STAP2 expression in IMR-32.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STAP2 is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — STAP2
Entrez GeneID
55620GeneBank Accession#
BC000795Protein Accession#
AAH00795Gene Name
STAP2
Gene Alias
BKS, FLJ20234
Gene Description
signal transducing adaptor family member 2
Omim ID
607881Gene Ontology
HyperlinkGene Summary
This gene encodes the substrate of breast tumor kinase, an Src-type non-receptor tyrosine kinase. The encoded protein possesses domains and several tyrosine phosphorylation sites characteristic of adaptor proteins that mediate the interactions linking proteins involved in signal transduction pathways. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
breast tumor kinase substrate|brk kinase substrate|signal-transducing adaptor protein-2
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com