Product Browser

Last updated: 2016/12/11
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UBE2Q1 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00055585-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human UBE2Q1 protein.
  • Immunogen:
  • UBE2Q1 (AAH15316.1, 1 a.a. ~ 71 a.a) full-length human protein.
  • Sequence:
  • MELLTKQGWSSAYSIESVIMQISATLVKGKARVQFGANKSQYSLTRAQQSYKSLVQIHEKNGWYTPPKEDG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of UBE2Q1 expression in transfected 293T cell line (H00055585-T01) by UBE2Q1 MaxPab polyclonal antibody.

    Lane 1: UBE2Q1 transfected lysate(7.81 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • UBE2Q1
  • Gene Alias:
  • GTAP,NICE-5,PRO3094,UBE2Q
  • Gene Description:
  • ubiquitin-conjugating enzyme E2Q family member 1
  • Gene Summary:
  • The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s), and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is 98% identical to the mouse counterpart. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000035378,galactosyl transferase-associated protein,ubiquitin-conjugating enzyme E2Q,ubiquitin-conjugating enzyme E2Q (putative) 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook