DDX43 monoclonal antibody (M07), clone 3G12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DDX43.
Immunogen
DDX43 (NP_061135.1, 2 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SHHGGAPKASTWVVASRRSSTVSRAPERRPAEELNRTGPEGYSVGRGGRWRGTSRPPEAVAAGHEELPLCFALKSHFVGAVIGRGGSKI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (57); Rat (56)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DDX43 expression in transfected 293T cell line by DDX43 monoclonal antibody (M07), clone 3G12.
Lane 1: DDX43 transfected lysate(72.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DDX43 is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to DDX43 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — DDX43
Entrez GeneID
55510GeneBank Accession#
NM_018665Protein Accession#
NP_061135.1Gene Name
DDX43
Gene Alias
DKFZp434H2114, HAGE
Gene Description
DEAD (Asp-Glu-Ala-Asp) box polypeptide 43
Omim ID
606286Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an ATP-dependent RNA helicase in the DEAD-box family and displays tumor-specific expression. [provided by RefSeq
Other Designations
DEAD-box protein 43|OTTHUMP00000016742
-
Interactome
-
Publication Reference
-
Arresting of miR-186 and releasing of H19 by DDX43 facilitate tumorigenesis and CML progression.
Lin J, Ma JC, Yang J, Yin JY, Chen XX, Guo H, Wen XM, Zhang TJ, Qian W, Qian J, Deng ZQ.
Oncogene 2018 May; 37(18):2432.
Application:WB-Ce, Human, K562 cells.
-
Arresting of miR-186 and releasing of H19 by DDX43 facilitate tumorigenesis and CML progression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com