RCBTB1 monoclonal antibody (M07), clone 1E4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RCBTB1 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.53 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RCBTB1.
Immunogen
RCBTB1 (NP_060661.3, 2 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VDVGKWPIFTLLSPQEIASIRKACVFGTSASEALYVTDNDEVFVFGLNYSNCLGTGDNQSTLVPKKLEGLCGKKIKSLSYGSGPHVLLS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RCBTB1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — RCBTB1
Entrez GeneID
55213GeneBank Accession#
NM_018191Protein Accession#
NP_060661.3Gene Name
RCBTB1
Gene Alias
CLLD7, CLLL7, GLP, MGC33184, RP11-185C18.1
Gene Description
regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1
Omim ID
607867Gene Ontology
HyperlinkGene Summary
This gene encodes a protein with an N-terminal RCC1 domain and a C-terminal BTB (broad complex, tramtrack and bric-a-brac) domain. In rat, over-expression of this gene in vascular smooth muscle cells induced cellular hypertrophy. In rat, the C-terminus of RCBTB1 interacts with the angiotensin II receptor-1A. In humans, this gene maps to a region of chromosome 13q that is frequently deleted in B-cell chronic lymphocytic leukemia and other lymphoid malignancies. [provided by RefSeq
Other Designations
GDP/GTP exchange factor (GEF)-like protein|OTTHUMP00000018413|chronic lymphocytic leukemia deletion region gene 7
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com