FBLIM1 monoclonal antibody (M10), clone 5E11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FBLIM1.
Immunogen
FBLIM1 (NP_060026, 270 a.a. ~ 373 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VTCARCIGDESFALGSQNEVYCLDDFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQGCYPLNNHLFCKPCHVKRSAAGCC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (59); Rat (74)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.18 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FBLIM1 monoclonal antibody (M10), clone 5E11 Western Blot analysis of FBLIM1 expression in HepG2 ( Cat # L019V1 ).Western Blot (Transfected lysate)
Western Blot analysis of FBLIM1 expression in transfected 293T cell line by FBLIM1 monoclonal antibody (M10), clone 5E11.
Lane 1: FBLIM1 transfected lysate(41 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FBLIM1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — FBLIM1
Entrez GeneID
54751GeneBank Accession#
NM_017556Protein Accession#
NP_060026Gene Name
FBLIM1
Gene Alias
CAL, DKFZp434G171, FBLP-1, FBLP1, RP11-169K16.5
Gene Description
filamin binding LIM protein 1
Omim ID
607747Gene Ontology
HyperlinkGene Summary
This gene encodes a protein with an N-terminal filamin-binding domain, a central proline-rich domain, and, multiple C-terminal LIM domains. This protein localizes at cell junctions and may link cell adhesion structures to the actin cytoskeleton. This protein may be involved in the assembly and stabilization of actin-filaments and likely plays a role in modulating cell adhesion, cell morphology and cell motility. This protein also localizes to the nucleus and may affect cardiomyocyte differentiation after binding with the CSX/NKX2-5 transcription factor. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
CSX-associated LIM|MIG2-interacting protein|OTTHUMP00000003118|OTTHUMP00000003119|OTTHUMP00000003120|filamin-binding LIM protein-1|migfilin|mitogen-inducible 2 interacting protein
-
Interactome
-
Publication Reference
-
Kindlin-1 Is Required for RhoGTPase-Mediated Lamellipodia Formation in Keratinocytes.
Has C, Herz C, Zimina E, Qu HY, He Y, Zhang ZG, Wen TT, Gache Y, Aumailley M, Bruckner-Tuderman L.
The American Journal of Pathology 2009 Oct; 175(4):1442.
Application:WB-Ce, Human, Human keratinocytes.
-
Kindlin-1 Is Required for RhoGTPase-Mediated Lamellipodia Formation in Keratinocytes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com