MRPS21 monoclonal antibody (M03), clone 1C5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MRPS21 is 1 ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant MRPS21.
Immunogen
MRPS21 (AAH04566, 1 a.a. ~ 87 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCRRRQRESYERCRRIYNMEMARKINFLMRKNRADPWQGC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (91)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MRPS21 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — MRPS21
Entrez GeneID
54460GeneBank Accession#
BC004566Protein Accession#
AAH04566Gene Name
MRPS21
Gene Alias
MDS016, MRP-S21, RPMS21
Gene Description
mitochondrial ribosomal protein S21
Gene Ontology
HyperlinkGene Summary
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S21P family. Pseudogenes corresponding to this gene are found on chromosomes 1p, 1q, 9p, 10p, 10q, 16q, and 17q. Available sequence data analyses identified splice variants that differ in the 5' UTR; both transcripts encode the same protein. [provided by RefSeq
Other Designations
OTTHUMP00000014527|OTTHUMP00000014921|mitochondrial 28S ribosomal protein S21
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com