Product Browser

Last updated: 2017/9/17
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DUOX1 polyclonal antibody (A01)

  • Catalog # : H00053905-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant DUOX1.
  • Immunogen:
  • DUOX1 (NP_059130, 941 a.a. ~ 1028 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • VEVPEVIKDLCRRASYISQDMICPSPRVSARCSRSDIETELTPQRLQCPMDTDPPQEIRRRFGKKVTSFQPLLFTEAHREKFQRSCLH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00053905-A01
    Western Blot detection against Immunogen (35.79 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • DUOX1
  • Gene Alias:
  • LNOX1,MGC138840,MGC138841,NOXEF1,THOX1
  • Gene Description:
  • dual oxidase 1
  • Gene Summary:
  • The protein encoded by this gene is a glycoprotein and a member of the NADPH oxidase family. The synthesis of thyroid hormone is catalyzed by a protein complex located at the apical membrane of thyroid follicular cells. This complex contains an iodide transporter, thyroperoxidase, and a peroxide generating system that includes this encoded protein and DUOX2. This protein is known as dual oxidase because it has both a peroxidase homology domain and a gp91phox domain. Two alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq
  • Other Designations:
  • NADPH thyroid oxidase 1,flavoprotein NADPH oxidase,nicotinamide adenine dinucleotide phosphate oxidase
  • RSS
  • YouTube
  • Linkedin
  • Facebook