POLR3K monoclonal antibody (M01), clone 3F5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of POLR3K expression in transfected 293T cell line by POLR3K monoclonal antibody (M01), clone 3F5.
Lane 1: POLR3K transfected lysate(12.3 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged POLR3K is approximately 0.1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to POLR3K on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.62 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant POLR3K.
Immunogen
POLR3K (AAH11932, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of POLR3K expression in transfected 293T cell line by POLR3K monoclonal antibody (M01), clone 3F5.
Lane 1: POLR3K transfected lysate(12.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged POLR3K is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to POLR3K on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — POLR3K
Entrez GeneID
51728GeneBank Accession#
BC011932Protein Accession#
AAH11932Gene Name
POLR3K
Gene Alias
C11, C11-RNP3, My010, RPC10, RPC11, hRPC11
Gene Description
polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa
Omim ID
606007Gene Ontology
HyperlinkGene Summary
This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the carboxy-terminal domain of an RNA polymerase II elongation factor. This similarity in sequence is supported by functional studies showing that this subunit is required for proper pausing and termination during transcription. [provided by RefSeq
Other Designations
DNA directed RNA polymerase III polypeptide K|RNA polymerase III subunit (hRPC11)|RNA polymerase III subunit CII
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com