Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

POLR3K polyclonal antibody (A01)

  • Catalog # : H00051728-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant POLR3K.
  • Immunogen:
  • POLR3K (AAH11932, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00051728-A01
    Western Blot detection against Immunogen (37.99 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • POLR3K
  • Gene Alias:
  • C11,C11-RNP3,My010,RPC10,RPC11,hRPC11
  • Gene Description:
  • polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa
  • Gene Summary:
  • This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the carboxy-terminal domain of an RNA polymerase II elongation factor. This similarity in sequence is supported by functional studies showing that this subunit is required for proper pausing and termination during transcription. [provided by RefSeq
  • Other Designations:
  • DNA directed RNA polymerase III polypeptide K,RNA polymerase III subunit (hRPC11),RNA polymerase III subunit CII
  • RSS
  • YouTube
  • Linkedin
  • Facebook