ACSL5 monoclonal antibody (M01), clone 5H8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ACSL5.
Immunogen
ACSL5 (NP_057318, 91 a.a. ~ 186 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81); Rat (81)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.3 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ACSL5 monoclonal antibody (M01), clone 5H8 Western Blot analysis of ACSL5 expression in HepG2 ( Cat # L019V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ACSL5 expression in transfected 293T cell line by ACSL5 monoclonal antibody (M01), clone 5H8.
Lane 1: ACSL5 transfected lysate(82.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ACSL5 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of ACSL5 transfected lysate using anti-ACSL5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ACSL5 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ACSL5 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — ACSL5
Entrez GeneID
51703GeneBank Accession#
NM_016234Protein Accession#
NP_057318Gene Name
ACSL5
Gene Alias
ACS2, ACS5, FACL5
Gene Description
acyl-CoA synthetase long-chain family member 5
Omim ID
605677Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
Other Designations
FACL5 for fatty acid coenzyme A ligase 5|OTTHUMP00000020489|OTTHUMP00000020490|fatty acid coenzyme A ligase 5|fatty-acid-Coenzyme A ligase, long-chain 5|long-chain acyl-CoA synthetase 5|long-chain fatty acid coenzyme A ligase 5
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Deficiency of Acyl-CoA Synthetase 5 (ACSL5) is Associated with a Severe and Treatable Failure to Thrive of Neonatal Onset.
Khalid Al-Thihli, Cassian Afting, Nadia Al-Hashmi, Mohammed Mohammed, Svenja Sliwinski, Naema Al-Shibli, Khoula Al-Said, Ghalia Al-Kasbi, Khalsa Al-Kharusi, Uta Merle, Joachim Füllekrug, Almundher Al-Maawali.
Clinical Genetics 2021 Mar; 99(3):376.
Application:WB-Tr, Monkey, COS-7 cells.
-
Modulating effects of acyl-CoA synthetase 5-derived mitochondrial Wnt2B palmitoylation on intestinal Wnt activity.
Klaus C, Schneider U, Hedberg C, Schutz AK, Bernhagen J, Waldmann H, Gassler N, Kaemmerer E.
World Journal of Gastroenterology 2014 Oct; 20(40):14855.
Application:IHC-P, WB-Tr, Human, CaCo2 cells, Colorectal adenocarcinomas.
-
TP53 status regulates ACSL5-induced expression of mitochondrial mortalin in enterocytes and colorectal adenocarcinomas.
Klaus C, Kaemmerer E, Reinartz A, Schneider U, Plum P, Jeon MK, Hose J, Hartmann F, Schnolzer M, Wagner N, Kopitz J, Gassler N.
Cell and Tissue Research 2014 Jul; 357(1):267.
Application:IHC, WB-Tr, Human, CaCo2 cells, Colorectal adenocarcinoma.
-
Gene expression profiling in sinonasal adenocarcinoma.
Tripodi D, Quemener S, Renaudin K, Ferron C, Malard O, Guisle-Marsollier I, Sebille-Rivain V, Verger C, Geraut C, Gratas-Rabbia-Re C.
BMC Medical Genomics 2009 Nov; 2:65.
Application:IHC-P, Human, Human sinonasal adenocarcinoma.
-
Promotion of glioma cell survival by acyl-CoA synthetase 5 under extracellular acidosis conditions.
Mashima T, Sato S, Sugimoto Y, Tsuruo T, Seimiya H.
Oncogene 2008 Sep; 28(1):9.
Application:WB-Ce, WB-Tr, Human, A1207, SF268, SNB78 cells.
-
Deficiency of Acyl-CoA Synthetase 5 (ACSL5) is Associated with a Severe and Treatable Failure to Thrive of Neonatal Onset.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com