NSDHL monoclonal antibody (M01), clone 6E3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NSDHL monoclonal antibody (M01), clone 6E3. Western Blot analysis of NSDHL expression in A-431.
Western Blot (Cell lysate)
NSDHL monoclonal antibody (M01), clone 6E3. Western Blot analysis of NSDHL expression in Raw 264.7.
Western Blot (Cell lysate)
NSDHL monoclonal antibody (M01), clone 6E3. Western Blot analysis of NSDHL expression in PC-12.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NSDHL is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NSDHL.
Immunogen
NSDHL (NP_057006, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEPAVSEPMRDQVARTHLTEDTPKVNADIEKVNQNQAKRCTVIGGSGFLGQHMVEQLLARGYAVNVFDIQQGFDNPQVRFFLGDLCSRQDLYPALKGVNTVFHCASPPPS
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (82); Rat (82)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NSDHL monoclonal antibody (M01), clone 6E3. Western Blot analysis of NSDHL expression in A-431.Western Blot (Cell lysate)
NSDHL monoclonal antibody (M01), clone 6E3. Western Blot analysis of NSDHL expression in Raw 264.7.Western Blot (Cell lysate)
NSDHL monoclonal antibody (M01), clone 6E3. Western Blot analysis of NSDHL expression in PC-12.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NSDHL is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — NSDHL
Entrez GeneID
50814GeneBank Accession#
NM_015922Protein Accession#
NP_057006Gene Name
NSDHL
Gene Alias
H105E3, SDR31E1, XAP104
Gene Description
NAD(P) dependent steroid dehydrogenase-like
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is localized in the endoplasmic reticulum and is involved in cholesterol biosynthesis. Mutations in this gene are associated with CHILD syndrome, which is a X-linked dominant disorder of lipid metabolism with disturbed cholesterol biosynthesis, and typically lethal in males. Alternatively spliced transcript variants with differing 5' UTR have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000025902|short chain dehydrogenase/reductase family 31E, member 1|sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com