MRPL42 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MRPL42 protein.
Immunogen
MRPL42 (NP_054769.1, 1 a.a. ~ 142 a.a) full-length human protein.
Sequence
MAVAAVKWVMSKRTILKHLFPVQNGALYCVCHKSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (76); Rat (73)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MRPL42 expression in transfected 293T cell line (H00028977-T01) by MRPL42 MaxPab polyclonal antibody.
Lane 1: MRPL42 transfected lysate(15.62 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MRPL42
Entrez GeneID
28977GeneBank Accession#
NM_014050.2Protein Accession#
NP_054769.1Gene Name
MRPL42
Gene Alias
HSPC204, MRP-L31, MRPL31, MRPS32, PTD007, RPML31
Gene Description
mitochondrial ribosomal protein L42
Gene Ontology
HyperlinkGene Summary
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a protein identified as belonging to both the 28S and the 39S subunits. Further experiments will be needed to identify the specific subunit localization. Sequence analysis identified three transcript variants that encode two different isoforms. Pseudogenes corresponding to this gene are found on chromosomes 4q, 6p, 6q, 7p, and 15q. [provided by RefSeq
Other Designations
mitochondrial ribosomal protein S32
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com