SULT1C2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SULT1C2 partial ORF ( AAH58861.1, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPSLGSGEYK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.96
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SULT1C4
Entrez GeneID
27233GeneBank Accession#
BC058861Protein Accession#
AAH58861.1Gene Name
SULT1C4
Gene Alias
MGC149521, MGC34422, SULT1C, SULT1C2
Gene Description
sulfotransferase family, cytosolic, 1C, member 4
Omim ID
608357Gene Ontology
HyperlinkGene Summary
Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. [provided by RefSeq
Other Designations
sulfotransferase 1C2|sulfotransferase family, cytosolic, 1C, member 2|sulfotransferase family, cytosolic, 1C, member C2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com