TIMM13 monoclonal antibody (M03A), clone 4F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (36.19 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant TIMM13.
Immunogen
TIMM13 (AAH08607, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Isotype
IgM Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.19 KDa) .
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — TIMM13
Entrez GeneID
26517GeneBank Accession#
BC008607Protein Accession#
AAH08607Gene Name
TIMM13
Gene Alias
TIM13, TIM13B, TIMM13A, TIMM13B, ppv1
Gene Description
translocase of inner mitochondrial membrane 13 homolog (yeast)
Omim ID
607383Gene Ontology
HyperlinkGene Summary
This gene encodes a translocase with similarity to yeast mitochondrial proteins that are involved in the import of metabolite transporters from the cytoplasm and into the mitochondrial inner membrane. The encoded protein and the TIMM8a protein form a 70 kDa complex in the intermembrane space. This gene is in a head-to-tail orientation with the gene for lamin B2. [provided by RefSeq
Other Designations
mitochondrial import inner membrane translocase subunit Tim13B|translocase of inner mitochondrial membrane 13
-
Interactome
-
Publication Reference
-
Low-molecular-mass secretome profiling identifies C-C motif chemokine 5 as a potential plasma biomarker and therapeutic target for nasopharyngeal carcinoma.
Lin SJ, Chang KP, Hsu CW, Chi LM, Chien KY, Liang Y, Tsai MH, Lin YT, Yu JS.
Journal of Proteomics 2013 Dec; 94:186.
Application：WB-Ce, Human, NPC-TW02, NPC-TW04, NPC-BM1 cells.
-
Low-molecular-mass secretome profiling identifies C-C motif chemokine 5 as a potential plasma biomarker and therapeutic target for nasopharyngeal carcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com