TIMM13 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length recombinant TIMM13.
Immunogen
TIMM13 (AAH08607, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag.
Sequence
MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.56 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — TIMM13
Entrez GeneID
26517GeneBank Accession#
BC008607Protein Accession#
AAH08607Gene Name
TIMM13
Gene Alias
TIM13, TIM13B, TIMM13A, TIMM13B, ppv1
Gene Description
translocase of inner mitochondrial membrane 13 homolog (yeast)
Omim ID
607383Gene Ontology
HyperlinkGene Summary
This gene encodes a translocase with similarity to yeast mitochondrial proteins that are involved in the import of metabolite transporters from the cytoplasm and into the mitochondrial inner membrane. The encoded protein and the TIMM8a protein form a 70 kDa complex in the intermembrane space. This gene is in a head-to-tail orientation with the gene for lamin B2. [provided by RefSeq
Other Designations
mitochondrial import inner membrane translocase subunit Tim13B|translocase of inner mitochondrial membrane 13
-
Interactome
-
Publication Reference
-
Nucleocytoplasmic human O-GlcNAc transferase is sufficient for O-GlcNAcylation of mitochondrial proteins.
Trapannone R, Mariappa D, Ferenbach AT, van Aalten DM.
The Biochemical Journal 2016 Jun; 473(12):1693.
Application:WB-Ce, Human, Mouse, HEK 293 suspension IL1R, HEK 293, Jurkat, SH-SY5Y, RAW, HeLa, U2OS, A549 cells.
-
Nucleocytoplasmic human O-GlcNAc transferase is sufficient for O-GlcNAcylation of mitochondrial proteins.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com