Product Browser

Last updated: 2017/8/20
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

APPL polyclonal antibody (A01)

  • Catalog # : H00026060-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant APPL.
  • Immunogen:
  • APPL (NP_036228, 611 a.a. ~ 708 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • EGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGEGGKKRESE
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00026060-A01
    Western Blot detection against Immunogen (36.89 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • APPL polyclonal antibody (A01), Lot # HRI0060508QCS1 Western Blot analysis of APPL expression in HeLa ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • APPL polyclonal antibody (A01), Lot # HRI0060508QCS1. Western Blot analysis of APPL expression in NIH/3T3.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • APPL1
  • Gene Alias:
  • APPL,DIP13alpha
  • Gene Description:
  • adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1
  • Gene Summary:
  • The protein encoded by this gene has been shown to be involved in the regulation of cell proliferation, and in the crosstalk between the adiponectin signalling and insulin signalling pathways. The encoded protein binds many other proteins, including RAB5A, DCC, AKT2, PIK3CA, adiponectin receptors, and proteins of the NuRD/MeCP1 complex. This protein is found associated with endosomal membranes, but can be released by EGF and translocated to the nucleus. [provided by RefSeq
  • Other Designations:
  • AKT2 interactor,adaptor protein containing pH domain, PTB domain and leucine zipper motif 1,signaling adaptor protein DIP13alpha
  • RSS
  • YouTube
  • Linkedin
  • Facebook