SUMF2 monoclonal antibody (M02), clone 4B3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SUMF2.
Immunogen
SUMF2 (NP_056226, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (76); Rat (77)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SUMF2 monoclonal antibody (M02), clone 4B3 Western Blot analysis of SUMF2 expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SUMF2 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — SUMF2
Entrez GeneID
25870GeneBank Accession#
NM_015411Protein Accession#
NP_056226Gene Name
SUMF2
Gene Alias
DKFZp566I1024, DKFZp686I1024, DKFZp686L17160, DKFZp781L1035, MGC99485, pFGE
Gene Description
sulfatase modifying factor 2
Omim ID
607940Gene Ontology
HyperlinkGene Summary
The catalytic sites of sulfatases are only active if they contain a unique amino acid, C-alpha-formylglycine (FGly). The FGly residue is posttranslationally generated from a cysteine by enzymes with FGly-generating activity. The gene described in this record is a member of the sulfatase-modifying factor family and encodes a protein with a DUF323 domain that localizes to the lumen of the endoplasmic reticulum. This protein has low levels of FGly-generating activity but can heterodimerize with another family member - a protein with high levels of FGly-generating activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
C-alpha-formyglycine-generating enzyme 2|paralog of the formylglycine-generating enzyme
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com