FBXO7 monoclonal antibody (M01), clone 4G8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunofluorescence
Immunofluorescence of monoclonal antibody to FBXO7 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FBXO7.
Immunogen
FBXO7 (NP_036311, 357 a.a. ~ 455 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (73); Rat (72)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to FBXO7 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — FBXO7
Entrez GeneID
25793GeneBank Accession#
NM_012179Protein Accession#
NP_036311Gene Name
FBXO7
Gene Alias
DKFZp686B08113, FBX, FBX07, FBX7, PARK15, PKPS
Gene Description
F-box protein 7
Omim ID
605648Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and it may play a role in regulation of hematopoiesis. Alternatively spliced transcript variants of this gene have been identified with the full-length natures of only some variants being determined. [provided by RefSeq
Other Designations
F-box only protein 7
-
Interactome
-
Disease
-
Publication Reference
-
Insulin action and resistance are dependent on a GSK3β-FBXW7-ERRα transcriptional axis.
Hui Xia, Charlotte Scholtes, Catherine R Dufour, Carlo Ouellet, Majid Ghahremani, Vincent Giguère.
Nature Communications 2022 Apr; 13(1):2105.
Application：WB-Tr, Human, HepG2 cells.
-
Insulin action and resistance are dependent on a GSK3β-FBXW7-ERRα transcriptional axis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com