FBXO7 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human FBXO7 protein.
Immunogen
FBXO7 (AAH08361.1, 1 a.a. ~ 522 a.a) full-length human protein.
Sequence
MRLRVRLLKRTWPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPLTGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTSIQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (73); Rat (72)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FBXO7 MaxPab polyclonal antibody. Western Blot analysis of FBXO7 expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of FBXO7 expression in transfected 293T cell line (H00025793-T01) by FBXO7 MaxPab polyclonal antibody.
Lane 1: FBXO7 transfected lysate(57.42 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to FBXO7 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Immunofluorescence
Immunofluorescence of purified MaxPab antibody to FBXO7 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — FBXO7
Entrez GeneID
25793GeneBank Accession#
BC008361.1Protein Accession#
AAH08361.1Gene Name
FBXO7
Gene Alias
DKFZp686B08113, FBX, FBX07, FBX7, PARK15, PKPS
Gene Description
F-box protein 7
Omim ID
605648Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and it may play a role in regulation of hematopoiesis. Alternatively spliced transcript variants of this gene have been identified with the full-length natures of only some variants being determined. [provided by RefSeq
Other Designations
F-box only protein 7
-
Interactome
-
Disease
-
Publication Reference
-
FBXO7 Y52C Polymorphism as a Potential Protective Factor in Parkinson's Disease.
Chen CM, Chen IC, Huang YC, Juan HF, Chen YL, Chen YC, Lin CH, Lee LC, Lee CM, Lee-Chen GJ, Lai YJ, Wu YR.
PLoS One 2014 Jul; 9(7):e101392.
Application:WB-Tr, Human, HEK-293T, SH-SY5Y cells.
-
FBXO7 Y52C Polymorphism as a Potential Protective Factor in Parkinson's Disease.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com