CLEC5A (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CLEC5A full-length ORF ( NP_037384.1, 1 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
47.9
Interspecies Antigen Sequence
Mouse (70); Rat (70)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CLEC5A
Entrez GeneID
23601GeneBank Accession#
NM_013252.2Protein Accession#
NP_037384.1Gene Name
CLEC5A
Gene Alias
CLECSF5, MDL-1, MDL1, MGC138304
Gene Description
C-type lectin domain family 5, member A
Omim ID
604987Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein interacts with dnax-activation protein 12 and may play a role in cell activation. Alternative splice variants have been described but their full-length sequence has not been determined. [provided by RefSeq
Other Designations
C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 5|C-type lectin, superfamily member 5|myeloid DAP12-associating lectin-1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com