Product Browser

Last updated: 2017/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF13B (Human) Recombinant ProteinHuPro Protein

  • Catalog # : H00023495-H01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Purified TNFRSF13B (NP_036584.1 2 a.a. - 165 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293T cells
  • Sequence:
  • SGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYS
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 23.32
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of pSuper-TNFRSF13B plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
  • Purification:
  • Strep-Tactin affinity columns
  • Concentration:
  • ≥ 10 ug/ml
  • Activity:
  • Not Tested
  • Quality Control Testing:
  • SDS-PAGE and Western Blot
    Western Blot
    QC Testing of H00023495-H01

    SDS-PAGE Gel
    QC Testing of H00023495-H01
  • Storage Buffer:
  • 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Gene Information
  • Gene Name:
  • TNFRSF13B
  • Gene Alias:
  • CD267,CVID,FLJ39942,MGC133214,MGC39952,TACI,TNFRSF14B
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 13B
  • Gene Summary:
  • The protein encoded by this gene is a lymphocyte-specific member of the tumor necrosis factor (TNF) receptor superfamily. It interacts with calcium-modulator and cyclophilin ligand (CAML). The protein induces activation of the transcription factors NFAT, AP1, and NF-kappa-B and plays a crucial role in humoral immunity by interacting with a TNF ligand. This gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000065442,transmembrane activator and CAML interactor,tumor necrosis factor receptor 13B
  • RSS
  • YouTube
  • Linkedin
  • Facebook