WWP1 monoclonal antibody (M01A), clone 1A7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant WWP1.
Immunogen
WWP1 (NP_008944, 152 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CSSSPTIEIQENGDALHENGEPSARTTARLAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADDTVNGESSSFAPTDNASVTGT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of WWP1 expression in transfected 293T cell line by WWP1 monoclonal antibody (M01A), clone 1A7.
Lane 1: WWP1 transfected lysate(105.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — WWP1
Entrez GeneID
11059GeneBank Accession#
NM_007013Protein Accession#
NP_008944Gene Name
WWP1
Gene Alias
AIP5, DKFZp434D2111, Tiul1, hSDRP1
Gene Description
WW domain containing E3 ubiquitin protein ligase 1
Omim ID
602307Gene Ontology
HyperlinkGene Summary
WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. The encoded protein belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. Alternative splicing of this gene generates at least 6 transcript variants; however, the full length nature of these transcripts has not been defined. [provided by RefSeq
Other Designations
Nedd-4-like ubiquitin-protein ligase|TGIF-interacting ubiquitin ligase 1|atrophin-1 interacting protein 5
-
Interactome
-
Pathway
-
Publication Reference
-
Lysosomal trafficking of the glucose transporter GLUT1 requires sequential regulation by TXNIP and ubiquitin.
Susan J Qualls-Histed, Casey P Nielsen, Jason A MacGurn.
iScience 2023 Feb; 26(3):106150.
Application:WB-Ce, Human, HeLa cells.
-
The ubiquitin E3 ligase WWP1 increases CXCL12-mediated MDA231 breast cancer cell migration and bone metastasis.
Subik K, Shu L, Wu C, Liang Q, Hicks D, Boyce B, Schiffhauer L, Chen D, Chen C, Tang P, Xing L.
Bone 2012 Jun; 50(4):813.
Application:IHC-P, Human, Thyroid adenoma, breast mucinous carcinoma, breast ductal carcinoma, MDA-MB-231 .
-
Lysosomal trafficking of the glucose transporter GLUT1 requires sequential regulation by TXNIP and ubiquitin.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com