Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RUVBL2 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00010856-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human RUVBL2 protein.
  • Immunogen:
  • RUVBL2 (NP_006657.1, 1 a.a. ~ 463 a.a) full-length human protein.
  • Sequence:
  • MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of RUVBL2 transfected lysate using anti-RUVBL2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with RUVBL2 purified MaxPab mouse polyclonal antibody (B01P) (H00010856-B01P).
  • PDF DownloadProtocol Download
  • Application Image
  • Gene Information
  • Gene Name:
  • RUVBL2
  • Gene Alias:
  • CGI-46,ECP51,INO80J,REPTIN,RVB2,TIH2,TIP48,TIP49B
  • Gene Description:
  • RuvB-like 2 (E. coli)
  • Gene Summary:
  • This gene encodes the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this gene product has both ATPase and DNA helicase activities. This gene is physically linked to the CGB/LHB gene cluster on chromosome 19q13.3, and is very close (55 nt) to the LHB gene, in the opposite orientation. [provided by RefSeq
  • Other Designations:
  • INO80 complex subunit J,Reptin52,RuvB (E coli homolog)-like 2,RuvB-like 2,TBP-interacting protein, 48-KD,erythrocyte cytosolic protein, 51-KD
  • RSS
  • YouTube
  • Linkedin
  • Facebook