RBCK1 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
RBCK1 MaxPab rabbit polyclonal antibody. Western Blot analysis of RBCK1 expression in human stomach.
Western Blot (Transfected lysate)
Western Blot analysis of RBCK1 expression in transfected 293T cell line (H00010616-T02) by RBCK1 MaxPab polyclonal antibody.
Lane 1: RBCK1 transfected lysate(25.70 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of RBCK1 transfected lysate using anti-RBCK1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with RBCK1 purified MaxPab mouse polyclonal antibody (B01P) (H00010616-B01P).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human RBCK1 protein.
Immunogen
RBCK1 (ENSP00000290048, 1 a.a. ~ 230 a.a) full-length human protein.
Sequence
MGTATPDGREDQERLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQGVPAGHHPQQPGGGGLLPLH
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (90)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
RBCK1 MaxPab rabbit polyclonal antibody. Western Blot analysis of RBCK1 expression in human stomach.Western Blot (Transfected lysate)
Western Blot analysis of RBCK1 expression in transfected 293T cell line (H00010616-T02) by RBCK1 MaxPab polyclonal antibody.
Lane 1: RBCK1 transfected lysate(25.70 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of RBCK1 transfected lysate using anti-RBCK1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with RBCK1 purified MaxPab mouse polyclonal antibody (B01P) (H00010616-B01P). -
Gene Info — RBCK1
Entrez GeneID
10616GeneBank Accession#
ENST00000290048Protein Accession#
ENSP00000290048Gene Name
RBCK1
Gene Alias
C20orf18, HOIL1, RBCK2, RNF54, UBCE7IP3, XAP3, XAP4, ZRANB4
Gene Description
RanBP-type and C3HC4-type zinc finger containing 1
Omim ID
610924Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is similar to mouse UIP28/UbcM4 interacting protein. Alternative splicing has been observed at this locus, resulting in distinct isoforms. [provided by RefSeq
Other Designations
HBV associated factor 4|OTTHUMP00000029921|OTTHUMP00000029922|RBCC protein interacting with PKC1|hepatitis B virus X-associated protein 4|ubiquitin conjugating enzyme 7 interacting protein 3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com